DPCstruct | MC18460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 238 ± 46 aa |
| Standard deviation of domain lengths | 45.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 36.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2GDS4 | 3-152 | FRKNKRVKQRLHETLQIDREFTEEDFEKLNPTKARSIHNALQFIKNPVRACEHVHELLQEINQLIKRKKEDPRLQEAPLYHGETWDL… |
| A0A287LR80 | 285-492 | TPPGLLRLHSTYRHDLKIYSSDEGRVQMSAAAFAKGLLDLEGDLTPILVSLVSKDSSMLDGLQDGTIEISEAKAQLHDFIISSKVAN… |
| A0A6I9PLR7 | 1-219 | None |
| A0A2J8IKB4 | 1-229 | None |
| A0A4U5M1L9 | 63-289 | None |
| A0A7J0EKR2 | 396-633 | None |
| A0A183W5Z4 | 283-598 | None |
| A0A7J6JVE5 | 1-204 | None |
| A0A6P6Q6V3 | 72-293 | None |
| A0A1D6NA38 | 335-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.