DPCstruct | MC1846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7XKV0 | 1-72 | MACDSSRFDVIIEKKIPLVLSVGALDMVNFGAKDTIPQNFQQRNIYEHNNQVSLMRTTVDENRKFADFIANK |
| A0A838VB44 | 2-72 | ARFDVTLERRLPNVLSVGALDMVNFGPIDSVPPQFTNRNLHVHNATVTLMRTTAEENVACAQWIARKLNAH |
| A0A6G1DWB2 | 91-160 | None |
| A0A0A9VGR5 | 186-247 | None |
| A0A7J8SNR8 | 1-90 | None |
| A0A7N2LBA3 | 132-203 | None |
| A0A7J0EUQ5 | 233-302 | None |
| A0A2A2HGH4 | 27-93 | None |
| A0A445EX67 | 318-387 | None |
| A0A7J8PN41 | 171-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.