DPCstruct | MC18459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 219 ± 28 aa |
| Standard deviation of domain lengths | 28.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 51.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287LQP2 | 6-197 | AAAVPRLLAPHQVEMFSHYVANQIGFEDPNQCPHLCTMAYDYLKKSQGYEQNLLAFFHNNMNPDALLVKLIEELDRCILGYFSFHWK… |
| A0A2K3MP84 | 2-169 | TRQIGFEDASEVPKLCLLAQEYLQKSKGCDQSIFEYLANEKDSESLYVKLVDEFEKCILSYLAFHWKQAPFVISQLMNVDESEHKTK… |
| F6HDZ0 | 8-253 | None |
| A0A452ZHP8 | 1-178 | None |
| A0A453HCW5 | 16-232 | None |
| A0A5N6PGC9 | 14-223 | None |
| A0A5N6PFG2 | 273-514 | None |
| A0A2P5BWR0 | 1-238 | None |
| A0A6J1IIR8 | 1-239 | None |
| A0A2P2KMJ7 | 32-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.