DPCstruct | MC18458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3NL65 | 97-187 | DSTATWRYGRLPDYSRTRNFYTEGKKMNHAAGSLESLVENLVKNWEIEASFKTDLKDWRTIDPEVGYSLSFNGGPARSARDVLTMGT… |
| A0A287LIK5 | 10-106 | GGDKYRSHLAGEGEKNTVWRHGAPPTYDAVNSLFEAGRTQEWPEGSLEETVQNAIKTWEMELSHKARIEDFKSVSPGRFTLSVNGGR… |
| A0A834ZIZ6 | 61-132 | None |
| A0A146HP41 | 149-261 | None |
| T1MDD5 | 1-79 | None |
| A0A4S8IR88 | 23-119 | None |
| A0A443PHC1 | 8-126 | None |
| A0A811NXX0 | 11-105 | None |
| A0A446NC09 | 1-89 | None |
| A0A4U5MWU0 | 5-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.