DPCstruct | MC18456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 322 ± 55 aa |
| Standard deviation of domain lengths | 54.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BIB0 | 245-596 | EKRTALQLLVSFNRIWVVHISLFWYYAAYNSPVIYRRAGSRDATAAMKWSASALGGAVSAAIMIAATLAEFTFIPTTWNNTSHLTRR… |
| A0A287L7E4 | 2-299 | LIVSWSSSGSLSGIADATVFRSVLSVFITAALLNFIKVTLDILLTFQAWGSMEWTQILRYLLKFFVAIAWIIILPVTYSSSIKSPSG… |
| A0A2P2MBJ8 | 472-850 | None |
| A0A453Q8I0 | 118-527 | None |
| A0A453Q8N9 | 33-355 | None |
| A0A453Q8Q3 | 362-770 | None |
| A0A7C9EUH7 | 139-411 | None |
| A0A287RHA0 | 309-618 | None |
| A0A287PW09 | 198-619 | None |
| A0A446PQL0 | 13-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.