DPCstruct | MC18455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 184 ± 37 aa |
| Standard deviation of domain lengths | 37.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.72 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0063- PF04759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7GDF9 | 2-159 | VIGTIFGNRRGHVWFCIQHDRLSTIPLLLLELSIPTHQLVKEMQCGLVRLALECNRSELNSVPLRAVPVWTVNCNGKKAGFALRRKA… |
| A0A287L5Z1 | 147-383 | EASMAFSSTCRSFHSEDLVSPPPKPLKQHRKNTKLGRTAVSRLRTALAAAISGRHRQVGLGSRLTGTLYGHRRGHVHLAFQVDPRAC… |
| A0A2R6XAG0 | 36-241 | None |
| A0A834Z522 | 534-712 | None |
| A0A7J7GNA1 | 178-336 | None |
| M4CKA0 | 70-260 | None |
| A0A5D2A698 | 31-233 | None |
| A0A0Q3PDL4 | 2-217 | None |
| A0A811MM02 | 41-209 | None |
| A0A6P5GHK8 | 36-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.