DPCstruct | MC18453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 135 ± 22 aa |
| Standard deviation of domain lengths | 21.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5YI45 | 14-162 | RAKSKKKNRSMTLLKAPDAKVSNGWYMYVPPCFNESLDIRRTERVIAKKKELVWTQGSWFSFKRGDTLYDTPKAYQVWSEALKYIGL… |
| A0A0N8UI49 | 49-154 | DHWNFKVGYCFREALDLFFMERKRNNKKVNLWSQGCIVSFKEGDLLYSRCGERAVQVKFASPMGWDETVNSMYYGSVTYDEMDLINK… |
| A0A840UYW2 | 5-144 | None |
| G7G1J1 | 250-360 | None |
| A0A090IEN7 | 36-216 | None |
| A0A2N3KUP3 | 148-264 | None |
| A0A1G3Y245 | 1-122 | None |
| A0A1G0RRW4 | 2-113 | None |
| A0A1V4WQL9 | 29-187 | None |
| A0A2G2PW29 | 98-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.