DPCstruct | MC1845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6RJW6 | 1-54 | MSSGVGSSSSIRQARDFAVAQAQQDGVLGNFKIFDSPFGNFLVPVIPTAKELAD |
| A0A5D2YTX1 | 2-77 | TVASPASKTPKDAKPTCSSRVPGVQTSEINSFRIQQEKNFAVAQAQQDGCTGNFKKFDSWYGNFLVPVVPSRAELN |
| A0A4U6URS0 | 81-151 | None |
| A0A0A0LEY3 | 84-150 | None |
| A0A0A9GJ11 | 29-105 | None |
| A0A2T7DH05 | 15-91 | None |
| A0A834SHP0 | 31-115 | None |
| A0A6A4PFS8 | 1-85 | None |
| A0A446PY61 | 7-64 | None |
| U5CYE0 | 21-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.