DPCstruct | MC18448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 19 aa |
| Standard deviation of domain lengths | 18.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A176YXP3 | 1-156 | MVSRLRHLGLAPDSDEPRMSYMIRGERYTAELGPGGDDDVQLIHHDRNAPMNEAGPSQARPSSPAAAAPPELGHLIDQNGRRVFDTW… |
| A0A850HV62 | 1-107 | MSYEIRGHRYTATQDPTSGTRLIHNPPEDQRMGEGPQGVPDFGAFFRETCRRNVPLPEQWAPLALIEKLREAGYMPTPDHPTTIALD… |
| A0A6N7LHQ6 | 521-685 | None |
| A0A562K866 | 108-253 | None |
| A0A6P1B753 | 466-630 | None |
| A0A6P1B6S4 | 43-189 | None |
| A0A837C7Y5 | 458-603 | None |
| A0A4Q7FXZ8 | 1-161 | None |
| A0A1C3XH86 | 15-178 | None |
| A0A560LCI2 | 301-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.