DPCstruct | MC18446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 319 ± 33 aa |
| Standard deviation of domain lengths | 33.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H4WZI0 | 148-483 | ALVSVAFVLAAPWLGVAGESPLWAWLLFVVCVDVAHVWSTLFRTYLDPEELRDRPGLYLGAPLAAYGAGVLAHLVSPGTFWTLFAYV… |
| A0A7Y8I4E3 | 35-363 | IILSAVVVLFPHVSHALVPSNVFVDQLVTMVVGGPHLFATYTMTVMEPDFRRRYPVYSKLAWLLPVIIVTLAALNLTLLVTIFFFWA… |
| X8EY45 | 3-291 | None |
| A0A2D5ZVS9 | 2-314 | None |
| A0A2E5JKR8 | 28-332 | None |
| A0A2E5I651 | 2-344 | None |
| A0A849T8U5 | 2-248 | None |
| A0A4Q6BR26 | 2-288 | None |
| A0A7Z9GX76 | 34-400 | None |
| A0A3F2V681 | 9-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.