DPCstruct | MC18445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 131 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5W2X3 | 220-356 | VGDERDLIKLRTNYRKDDVYIYRTRATPEQARAMFVDVFRRVNQLKDTPEFYNTFTNNCTTNIVQHVNNLSPALVPYDYRVMLPGLT… |
| A0A410E811 | 48-177 | ILADEEDLFALRTNYRKEDMYLYRINIGRESLKKAFLGFAEKINSLHERPRYYHTVTANCTTELVDTFKSYLGVRRWQWTPVFNGMC… |
| A0A1V4WK11 | 1-117 | None |
| A0A0G1BJN5 | 56-188 | None |
| A0A177GCL5 | 28-168 | None |
| A0A3C1QUU9 | 227-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.