DPCstruct | MC1844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J7J934 | 1-107 | MIGFTPEQLVALSKANTAAMLALTSQAFEGCEQVIQLNLQVARQALDDSRSYLTEALSWKSPEQAIAQQTKHLQSRAERALTYGGQL… |
| A0A2V3RAQ9 | 1-118 | MNTVIPHQFVEAHTPNVQQLFGLSNSAFAGLEKLTALNLQAIKVTLAENQAIMMKAVSARPEELFVLSTSLAKPMAEKVSAYSRQVY… |
| A0A375GJL4 | 1-124 | None |
| A0A7I8BU09 | 1-132 | None |
| A0A556A936 | 1-127 | None |
| A0A1Q8IWN5 | 1-119 | None |
| G4MFT9 | 1-127 | None |
| A0A7I8CXZ8 | 1-103 | None |
| A0A2Z5MJD3 | 35-167 | None |
| A0A7I8CMN1 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.