DPCstruct | MC18439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366DWA2 | 1-70 | MDTTQPAGRLRSTTAQGATAVWYVHEGVVRVVSIVDADGRTTDLDGEHLGGCFDLMPRRLWERVRYEYET |
| A0A231GZJ7 | 3-91 | DRTRCTAVNGLEAEWTMQNYRHIEIRRGRDPATGDVIEFAPGTDLAAAREQTSRHWAAVWDRVAHEMWTAWIPGQRNSESATPMTRF… |
| A0A1A0K4Z8 | 13-97 | None |
| A0A2S6APV3 | 1-77 | None |
| A0A6G9Z0D6 | 2-78 | None |
| A0A7W9ULP5 | 1-79 | None |
| A0A7G1KQ37 | 2-73 | None |
| A0A164LPW8 | 4-79 | None |
| A0A164HGF3 | 221-298 | None |
| A0A161XDE6 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.