DPCstruct | MC18433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 121 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I2GCB2 | 442-547 | QQYLSGKSCQVKFGLTCGQFTFAIPQGLELEFKQGDQVVIQFHLASSEHPRKHVGDARGTDPACRLAVSISGHDGQGRFHAWLLVKG… |
| A0A7U2QSS8 | 6-113 | RQNAHRVSCSDFEFTISRRLQLGVKVGDEVMLQFQLTETLNPEMYATKASIRDPASRLAVSIKGKGANGDYFVWLKNDGEKTVMIMN… |
| A0A830IP23 | 217-366 | None |
| A0A395MEI8 | 135-253 | None |
| B6QD95 | 181-304 | None |
| A0A6A6I0V8 | 13-111 | None |
| A0A162KMR0 | 329-442 | None |
| A0A4Q4Z1D7 | 752-889 | None |
| A0A1V6SRJ8 | 707-841 | None |
| A0A1L9TZV5 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.