DPCstruct | MC18431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166B0N9 | 91-223 | AVPTLPPQEVTNHISGGWYHIRSISNHALCWHYDAAENRIRASGDEPTPFRISIRNGVPEETIMASKDRITLYISSHLHVDIGQSGQ… |
| A0A7U2MRE7 | 17-128 | RFYIRSKSDPTVFWHDNDGFIVASKTERTKFRVTGKTRLEKDYVMIRSDLISITVIGKDNGYIRNDDGILVTGGSGNDTFLFSEFTT… |
| A0A167XPN4 | 89-228 | None |
| A0A5N6TJH4 | 1-146 | None |
| A0A0S7DU60 | 150-297 | None |
| A0A5N6FNY3 | 78-214 | None |
| A0A165RJ52 | 50-195 | None |
| A0A1F5LIL3 | 151-312 | None |
| A0A4Z1HBZ4 | 93-244 | None |
| A0A167VTG0 | 128-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.