DPCstruct | MC18430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | PF12359- PF12340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0TVX9 | 15-137 | NAVRRYITQWDMSGKEIEAVEKSPFWHESTINHVLLLRGLFASGILSFVFAQKRWRVNYGLDPNREKTTKLAVPFRAKDNPTPRSEF… |
| A0A7U2MP34 | 13-144 | GFWGPGTRDVLFLLRGLFAGGILVFAFGLKRWRVNYGLTSTREPSTKLAVPYRAKDSPTARSEYSHPDAVIVLTCLSWYYGGLSNED… |
| A0A0D2G9G7 | 97-228 | None |
| F4PXJ5 | 1-128 | None |
| A0A822DX26 | 473-630 | None |
| H0EN30 | 476-593 | None |
| A0A2K0UV93 | 1021-1140 | None |
| A0A834S6Q8 | 102-239 | None |
| A0A820T5Z1 | 131-257 | None |
| A0A842Z362 | 8-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.