DPCstruct | MC1843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3KDB4 | 1-80 | MPKVVVEANTFLKKRLLSSSDLSDAEKVFAEKGTTFEVADYAPDRNQHVFLKLSTPLKAEDKTTNLDCVYAYDPHVKVQG |
| A0A1U7N9P2 | 299-380 | RGTLPQTGVRLRVLRDTLFKTSTQQSYQLKDSQKVFVKADTEFEITSDQLAENKHIQIVLANVALGTPPRKTWYVFCDHVDI |
| B1WPV6 | 2-80 | None |
| H1W7K2 | 3-85 | None |
| H1WM10 | 351-432 | None |
| K9Q2Y6 | 1-83 | None |
| A0A2I9CPR1 | 1-82 | None |
| A0A168SE14 | 96-173 | None |
| A0A1Z3HTC3 | 354-439 | None |
| Q10YH6 | 91-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.