DPCstruct | MC18429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 171 ± 16 aa |
| Standard deviation of domain lengths | 16.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9BR87 | 2-177 | VDARFARRQATLSCAIIRNIAFYYAGWVTGDGQGRLKDDTDVGRTINSNFIDVAVLEWSKLFVDWEAKHHWRRFVKDTEARTAFRSG… |
| A0A101LJJ0 | 2-184 | DRTKLLTCAEMNCMSFVKNLALSGATREQLGRGKVLSNFWSQISRNALDLAVLDWCHAFGQQKDALHWKNVFPDDEEAFRESMLTWM… |
| A0A3P3VMU7 | 30-199 | None |
| A0A356R542 | 1-203 | None |
| A0A378JRE6 | 94-249 | None |
| A0A2A4ZW97 | 4-142 | None |
| A0A0D5NLQ6 | 1-154 | None |
| A0A1E7IGP6 | 1-176 | None |
| H8W5A8 | 56-236 | None |
| D8P5Y2 | 7-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.