DPCstruct | MC18428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S9WF40 | 1-96 | MEPVDDGFIVIDLLGRRRTGVVDWMLAEETLDDLGLGYLADPYELRLDDGTWLRVRIAEVSPSTIRVKKDDWGDMTATQISYSVAFP… |
| A0A420XCE1 | 1-147 | MPAPSDWIEHRRGDAELLGWMRPEGDGFVVIDLLGRSMTDAVDWLSAEETLEATGLGYLAEPFELLLDAAAAGTGVAPTGLDAAAAR… |
| A0A4Y9Q8T0 | 2-132 | None |
| A0A7Z0EJJ8 | 2-123 | None |
| A0A367FKI0 | 1-120 | None |
| A0A6I3M4H7 | 1-120 | None |
| A0A853A3N4 | 2-124 | None |
| A0A1H5IQD7 | 67-183 | None |
| A0A1H0H1H1 | 30-155 | None |
| A0A1G7KL30 | 28-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.