DPCstruct | MC18421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 189 ± 38 aa |
| Standard deviation of domain lengths | 37.92 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5CZ61 | 1-173 | MATVIPFRGLRYNPAKVENLAHVVTPPYDVIDAAAQDYYYKRHPYNIIRLEYGKAYPWDSETSNRYTRAACNFAAWLKESVLVPEAL… |
| A0A090X3H3 | 2-152 | PIIKPFKGVRAAPHMASHVISRTYQDYSDTELEAILKYNPFSFLHILNPGYKFSNSLKGEERFNLVRNRYLEFKEEQYLVQDESPVF… |
| A0A534U1F5 | 1-189 | None |
| D4IYE2 | 1-129 | None |
| A0A521U0M3 | 145-349 | None |
| A0A7C2KTK0 | 207-391 | None |
| A0A2V7S122 | 33-190 | None |
| A0A4Q3VAQ6 | 2-200 | None |
| A0A2N3XZ85 | 172-338 | None |
| A0A1W9TMD7 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.