DPCstruct | MC1842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2LDJ1 | 64-180 | YAQALRAWVDSQFKDESRLLQGQALQDALAWAAGKSLSNEDYEFLSASQKLDKREIEIALEVKEEEGRILAQANETLTKAQKKAKRQ… |
| A0A1U7N5L9 | 1-120 | MLNQSLNAWLASNRQDNSRLLRGEALAEALNWKAGKRLSLVDDEFLAASQELSWIEQQRYLEAERAKEVEARLAEQKKSARRLKFLL… |
| A0A846BQ12 | 257-355 | None |
| A0A2T1BYU5 | 42-158 | None |
| A0A1Z4JTD5 | 3-106 | None |
| A0A832H3V8 | 227-325 | None |
| A0A1Z4GZA6 | 147-253 | None |
| A0A328ICH5 | 44-152 | None |
| A0A1Q4RIK8 | 118-199 | None |
| G5J6T2 | 151-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.