DPCstruct | MC18419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2LKH7 | 50-115 | RGLYFASRWDDVYEPLLAMHDVDEQPLKGALVSGIIGNGRHTHTSLVLHHQMDKLVPGAFCLMANL |
| A0A090WLH7 | 1-82 | MYFPEKWDPAFTPILGMNDNGEEMTNGSLIVARYGNGHIIYTGLSLFRELPAGVSGAYKLLANMVSIGVDDQPVKKNSDEKF |
| A0A2V9GMH1 | 247-310 | None |
| A0A7V5T7T6 | 501-572 | None |
| A0A2V7K8E1 | 1-75 | None |
| A0A2V5QJN6 | 426-497 | None |
| W1SHE3 | 42-112 | None |
| A0A812QMQ4 | 605-672 | None |
| A0A3D1HRK5 | 24-93 | None |
| A0A7T9CJX8 | 805-873 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.