DPCstruct | MC18416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510JR14 | 3-73 | FSVRILLIHLSNHANTKHEKDECGTETIDNHLRWNKSFLDKVIEKAKKEKYIYVDNDVFKVSEKGEKYLLN |
| A0A090QAI3 | 2-82 | FRQSRQRIEVSLLTFLLHLNNHDSENERRVAHLQEHINWRKVKANSVLQLAEKNNMITIDNQIVSLTDKGLEFTEKALDYI |
| A0A7Y5QEU1 | 255-344 | None |
| A0A7X9CEZ4 | 79-166 | None |
| A0A7C6W526 | 116-198 | None |
| A0A6B1E6W3 | 176-265 | None |
| A0A7W0GA54 | 226-307 | None |
| A0A847N525 | 7-91 | None |
| A0A090WAR1 | 90-176 | None |
| A0A1M5W4J1 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.