DPCstruct | MC18415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 20.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P2QAL3 | 30-156 | LLVALARQVERQRWLMRVWHERLDTDAFEGEVPGMPGWTFLFHGDGLCLTAPDGEAIDVDDHGDGGLTIDPYFFARRILSLPRPALP… |
| A0A090PZD3 | 48-183 | LIQDYQKSVDEVVAIFQKRYGVENLLDGWHSGLYEQTGKLKEYGIKFYAFHGIGLSTHFEDKLVDFDFAFFPEPKWNGFDLWRLKSF… |
| A0A556N649 | 99-247 | None |
| A0A0N0E1M0 | 7-134 | None |
| A0A4R6SY92 | 162-301 | None |
| A0A1H6A260 | 14-137 | None |
| A0A7V8F9L4 | 9-112 | None |
| A0A561QNN9 | 11-132 | None |
| A0A4Q7JEG5 | 1-121 | None |
| A0A6C2YL59 | 2-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.