DPCstruct | MC18412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150GRZ3 | 195-283 | QRVYRNANGAVCLRFHKTDIVVVRPNGEVVLTSGGYKTRTTFCSVAEGIEPLGLTLRSSGGEGRGDWFVELPDGGQLPWEDGMTVPA… |
| A0A3E0QRU4 | 6-105 | IQMNNAISDSKNWKLANTEVTFDRESGHSRVYLHGNHIATVGENFVTITDGGYQSRTTKSRLNAILREHCVEGESVYQKRGEWFVTT… |
| A0A2W4YR93 | 1-95 | None |
| R1DUY6 | 56-149 | None |
| A0A497C1W4 | 7-95 | None |
| A0A2E7AVS9 | 29-134 | None |
| A0A2D6XJW5 | 1-110 | None |
| A0A7S0L7D2 | 92-181 | None |
| A0A382SAJ1 | 2-105 | None |
| A0A2D8U464 | 4-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.