DPCstruct | MC1841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8HZ07 | 2-106 | LTLDQQAQLAKLPREVVLTLKDYPSVAENYLDNKDLPPLPQNHECRLLEFYYDCAELPILTIENGVLSSHPAAAVIPTIIEVMDETS… |
| A0A1U7MXN4 | 1-93 | MFYNNKINPVEDLDRATNNLSDLPSLPIDYFPNVIEIFDQYGLLAGVVVSKGIPYEMPRHNDQVSDYNAWYFDGQLCVFYRGKNILL… |
| B4VV17 | 15-111 | None |
| E0UND2 | 4-99 | None |
| A0A1Z4JRI4 | 38-137 | None |
| A0A1D2PA65 | 6-119 | None |
| A0A7Y3TT23 | 66-166 | None |
| A0A2H2Y9K7 | 5-84 | None |
| A0A3S0ZHJ3 | 7-116 | None |
| A0A6I5PLH2 | 3-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.