DPCstruct | MC18408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 194 ± 34 aa |
| Standard deviation of domain lengths | 33.93 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350JJH8 | 13-181 | SEKLVLKPGENGWDKYLQLVGQAYMDAPDEQPEAVASYEALAEWVNKFFERIVGVVDVEFVDYHPYKSSKEMIQRVKDEGVLLISTA… |
| A0A6N7D573 | 3-159 | ITENMLSGARKALSRWTLDRAHRLAKDVGFSYEPVSEGYPETYEAVAEEFRQCNAARRGFRVWAGASDKTIYTSAEANWAFRYIHDV… |
| A0A7M2GK88 | 131-360 | None |
| A0A6A6RT64 | 41-267 | None |
| K9WNQ9 | 3-165 | None |
| A0A7W7Q8V8 | 378-608 | None |
| A0A5C7M8Y9 | 17-198 | None |
| A0A5S9NVQ6 | 27-254 | None |
| K9Y066 | 5-151 | None |
| F8CKG7 | 29-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.