DPCstruct | MC18406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7HG89 | 75-164 | ATINNGTCVYDVLGCMDKEAKNYNENATKDDNSCEYYILGCTDSNAKNYNKDADKDDGSCKYDIKGCMDSSAENYNKNATVDDGSCS… |
| A0A349MAU2 | 10-121 | CDELEILGCTYEAACNYDLDANVDDGQCDFSCLLAGCTDSDAVNYDAAATVEDGSCLFVGCTDPDGLDYDATANYPGGCDYPEACPG… |
| A0A2D5AFV7 | 64-158 | None |
| A0A2D5AGD0 | 1070-1157 | None |
| A0A2E6QWS1 | 448-534 | None |
| A0A2D5DXV6 | 166-251 | None |
| A0A7R9YPE9 | 2-106 | None |
| A0A2E7HP90 | 180-268 | None |
| A0A2E7HSX2 | 29-121 | None |
| A0A6V8EWN7 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.