DPCstruct | MC18405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 8.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1TB34 | 7-118 | FRYLREPLFVLAAAVYVGNVVWKHFAPADATFARCYLGDTLCLPVCVPLLLWLQRRSGVRGHDLPPSRRELLGLWLLWTVCFEWLGP… |
| A0A349D8C0 | 1-130 | MKSVLKTLSSPLFLVASCIFLVNRWSEFYGIYIPFVNSYLDDLMLMPIVLTMALAGMRFIISSSYRLSLWQISLSTLIFSVFFEYFI… |
| A0A1G6V000 | 1-119 | None |
| A0A286FBV7 | 15-124 | None |
| A0A520RPI7 | 11-121 | None |
| A0A7X7F3T1 | 3-128 | None |
| A0A2D0N0F3 | 2-103 | None |
| A0A243WCE8 | 17-132 | None |
| A0A2H1YEY2 | 8-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.