DPCstruct | MC18402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2711 |
|---|---|
| Mean domain length (aa) | 188 ± 38 aa |
| Standard deviation of domain lengths | 37.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.68 |
| Pfam Score | 93.39 |
| Assigned Pfam label(s) | PF10307- CL0029- CL0255- CL0137- PF18143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U4UDJ0 | 40-231 | AQQAPIHWVSVTQIAKSLDGLPPMAVGFDIDDTLLFSSPGFYRGKQEFSPNDESYLKNPAFWEKMNNGWDAFSVPKELGKALIAMHL… |
| A0A842M081 | 2-171 | IRAVIFDLDGTLTEFNVRVGEVKRAIGCGEMPILEFLETLDEEKRRRAERILREEEIRAAKSCELKKGVKELLENLRRRGLRLAILT… |
| A0A2B4SR15 | 441-673 | None |
| A0A5N9AI46 | 5-228 | None |
| A0A5N9AIE2 | 2-205 | None |
| A0A5C6T212 | 378-646 | None |
| A0A7I8KN62 | 1-204 | None |
| K8EIK8 | 15-199 | None |
| A0A7I8KX04 | 8-158 | None |
| A0A1T4NXI3 | 4-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.