DPCstruct | MC18401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 204 ± 30 aa |
| Standard deviation of domain lengths | 30.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832M1Y8 | 15-220 | LDRLVAALKGTPAYEEALKEALQRDMDVGRALEVIAALQRGEVGVARVRGPTPLTLEAERSLREGLEPALPERRELLSYALFKARLL… |
| A0A842LQJ8 | 2-208 | FAPLLETYRGTAVYREALREIFHERLDVERLKGFLKELREGKISIKSSSPLPLTATGYYGEFGIVIPQRSEISVLQAVKERIMNERV… |
| A0A7J3BCA0 | 38-255 | None |
| A0A7J4B1P8 | 2-177 | None |
| A0A662IKG7 | 1-160 | None |
| A0A497SZZ3 | 397-608 | None |
| A0A537FHU7 | 22-244 | None |
| A0A7J3HN55 | 233-447 | None |
| A0A5E4P5T7 | 62-294 | None |
| A0A2R4ZT57 | 588-818 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.