DPCstruct | MC18399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 192 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 15.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F1UHV0 | 2-105 | TAEFYARVREDEILAPMYPQDDFEGAQRRLLMFLEQYWGGPRTYSEERGHPRLRMRHASYRIDPAARDAWLRHMRAAVDTLELSPLH… |
| K9ZW04 | 133-242 | GGEAALRAVLRDFYTRARHDQVLGPVFTAHVHDWDAHIDRVQDFWVTALSGIPRYQGNLNVAHAHLGIRAEHLTRWLSLFEAACGEG… |
| A0A1D2RXF3 | 26-152 | None |
| A0A851HQY6 | 214-348 | None |
| A0A2J8AG44 | 5-143 | None |
| A0A3E2YUR2 | 7-110 | None |
| A0A353FYL8 | 2-124 | None |
| A0A4Q3JXI2 | 103-227 | None |
| A0A1Y5ED65 | 13-134 | None |
| A0A7J6KW69 | 497-621 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.