DPCstruct | MC18398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2U4X6 | 1-115 | MQQNNQITKGLVAIAHHYGSGKAEEKDITYTAKGVPKLVLNKDAKQITYVLYDRESANGKCALYVVYKAELAASDTEPEIGDMLAYE… |
| A0A0R2KR80 | 356-487 | PKTPVQPQESEPKQESLSVQIEKGMHQIFAQEFASHSGFQYRQDYNAQGQPIGIVFENQHHINYLLFDKKSSNQKCLLYIYYQSQKN… |
| A0A414K9J4 | 78-203 | None |
| R6GHL1 | 86-228 | None |
| F7V534 | 196-362 | None |
| A0A1E9XTS3 | 20-149 | None |
| A0A1C6FDK3 | 66-206 | None |
| A0A316S522 | 31-165 | None |
| A0A1Y4FG77 | 168-311 | None |
| A0A416NQJ2 | 195-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.