DPCstruct | MC18395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5PXD4 | 9-120 | FGDLSATARTRREILERLIPRLAIADRCTFDDKFLIVRGDLRTYKIHLGSSNILMEPNDQYLCIVPGRGAGPGDKIYLPFEGDRRFA… |
| A0A7K3B8E6 | 20-126 | ELTANAEIRREALRRIVPRLRIADRCTLEGRYLTVRGDLTTYRIHLGSANVLMAPDDAYLCIVPARRKADRGVFLPFEDDRLALILS… |
| A0A059U1U0 | 718-823 | None |
| A0A1T4SRE1 | 133-234 | None |
| A0A7J2IWG2 | 232-338 | None |
| A0A839IYY8 | 1-88 | None |
| A0A838URF9 | 19-126 | None |
| A0A2A5GZ74 | 90-211 | None |
| A0A844MSD6 | 23-104 | None |
| A0A529I0B3 | 38-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.