DPCstruct | MC18394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 267 ± 38 aa |
| Standard deviation of domain lengths | 38.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.08 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF13828- PF13845 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2L3U3 | 6-229 | EYATDVTVVDCARPHIGEVTGGFKVTGFRTWPGEDAIDAIAQKRCETVNGGYALDTWAVPKDVWVYYYLPSAQSWRLGDRTVTCVFA… |
| A0A7M2SI88 | 23-264 | QRSVFTLHVGDCYNPNSKGEGEETLVEIVPCEEAHTGQVAAEFQIFDVKTFPGDEEVSAIADERCPVEVAKFAPDTWALPKGVSLFY… |
| A0A561EHW7 | 118-402 | None |
| A0A421LQ68 | 28-281 | None |
| A0A6L8N8E9 | 198-473 | None |
| A0A7Z0PZ52 | 77-342 | None |
| A0A2G7DUW4 | 292-554 | None |
| A0A1C4MK17 | 70-328 | None |
| A0A419YCK6 | 51-284 | None |
| A0A2N0EN62 | 91-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.