DPCstruct | MC1839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3MFD3 | 1-77 | MVVNTKRFGQIEIESNQMIVFESPILGFGDLKNYVLLPSEDKNGPFEFLQSVENENLSFIVTDPFVFFLNMNFGLNH |
| A0A7V1LJ33 | 1-72 | MKITSYQFGEIEYTQEHLINFSSGLFGFENLRNYLLIKIEEEIFFWLTSIEKPEIIFPLIGIRVIDDKYPEV |
| S0EZL1 | 43-126 | None |
| H2J5V3 | 3-88 | None |
| A0A1V5U5Z3 | 1-86 | None |
| A0A136M1F4 | 15-100 | None |
| A0A7V3BQQ7 | 1-87 | None |
| A0A5J6LGL9 | 31-129 | None |
| A0A5S9MGK5 | 1-86 | None |
| A0A1F9BIB9 | 12-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.