DPCstruct | MC18389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X3I4F6 | 19-83 | MYVTASDGDTLDLLCWRHYGTTQHITEQVLIANPGLCEKGPRLPAGTRVRLPDITPVATATLIQL |
| A0A786TT65 | 1-56 | MKVKALEGDTVDSLCFRYYGTTQGVTEKVLDANPGLCQQVFLDAGQEVEMPEPEKK |
| A0A1A9VKI1 | 340-407 | None |
| A0A1I7HNC1 | 72-131 | None |
| A0A6N7JGT6 | 2-68 | None |
| A0A5F1U8F8 | 1-64 | None |
| A0A376SBV1 | 1-67 | None |
| A0A2W5H3R5 | 93-163 | None |
| A0A1X7MAH8 | 2-72 | None |
| A0A4P9VJG3 | 38-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.