DPCstruct | MC18386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 233 ± 32 aa |
| Standard deviation of domain lengths | 31.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194V139 | 1-223 | MDAFHEHIPHAARSRSWNILIFVNTSIIAGVYQRGDLLRVADLTHELDLCFVFDRPDDDKQWQPALLPRVTTARHSLTILDHQDKQP… |
| A0A2P5HFS5 | 2-269 | MAGITQDQRMLAWNVQFLVSVGPVAGIYQRDDFLSIADVSHELDMCLQFPQPEGAWRAILLPIDSCRRDTRVPQSSGPDHAQAALTI… |
| A0A194WAQ7 | 2-208 | None |
| A0A0B4H096 | 9-250 | None |
| A0A2N6ND83 | 2-278 | None |
| W9J7W4 | 5-204 | None |
| A0A194W7C8 | 1-155 | None |
| A0A194W261 | 1-236 | None |
| A0A194VSQ2 | 1-217 | None |
| A0A0G4N5L3 | 3-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.