DPCstruct | MC18385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 442 ± 60 aa |
| Standard deviation of domain lengths | 59.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.77 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0465- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8S0W5 | 6-342 | GDSPIELDPSAVLDTAAMDDLFRQVPLSILIAAGITGFKVPDIERRIRDAYSQDPSSIHVKDNQGQSALRAAIYAKNLVAIQALLAL… |
| A0A2G7G396 | 52-434 | SDILLIHKLEVSPSHRRRVIGSKLAGAILELASKKSKSFIGITSPGVAEDEWTSVTEDDISRSLEIEHDYDLPHVPQMPHIPEIDSL… |
| A0A229Y086 | 100-562 | None |
| A0A284R1W6 | 336-791 | None |
| A0A2P4ZZ09 | 69-460 | None |
| M2QY83 | 55-530 | None |
| W9Y254 | 229-736 | None |
| A0A1M2VXT5 | 60-569 | None |
| A0A2B7XKC7 | 389-864 | None |
| A0A7S4FC30 | 120-629 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.