DPCstruct | MC18382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 186 ± 34 aa |
| Standard deviation of domain lengths | 33.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7TX10 | 20-137 | IVEWALEVTEQNAGLLIRKSQDRAIFEPFKRSPDNASIMTTRGRLIRQFPSVSVSVPADVIEEPGFNQVIASTLATMSYQPVPGMRP… |
| A0A2G7FQZ1 | 3-221 | TPNADERLLIGALEYLINHVFLPLKVPQQDDHDPDHERFLVGFVLTALKEFKCYIATEWHSTTDLVVAMVRNLENMLDPAGCMDPEQ… |
| L7ISD1 | 14-221 | None |
| A0A4Y8CB38 | 2-163 | None |
| A0A3N4K8M1 | 8-160 | None |
| A0A2H2ZLJ1 | 14-206 | None |
| W2RJS0 | 5-158 | None |
| W9WT24 | 2-229 | None |
| A0A4Z1INM4 | 1-206 | None |
| A0A1J8PVI9 | 123-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.