DPCstruct | MC18381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 193 ± 23 aa |
| Standard deviation of domain lengths | 22.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6TFC9 | 3-187 | CSCGACLNGALSPRMACRLKRTAPGCSDMIIESISWPGEGPVHDPQVYMLDYVPPELRIEVTRQFVVGFANCMAAAGYLVSQGQLPK… |
| A0A2G7FJJ0 | 41-216 | SLGKPYSRSKCSCGECIAGFLSPRMRVFLEWHANRWWCFLRDNIEEGEAWTRLNAENLIFASPELQLELAQRRAMREGFAGISGFIA… |
| A0A4V6MWR0 | 5-212 | None |
| A0A1B8DYB0 | 143-325 | None |
| A0A2G8S0W5 | 154-377 | None |
| A0A229Y086 | 382-562 | None |
| A0A7M5X3P2 | 252-448 | None |
| A0A284R1W6 | 577-775 | None |
| A0A5C2SPU0 | 6-187 | None |
| A0A0C2YXM1 | 6-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.