DPCstruct | MC1838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13619 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X5DFR8 | 97-169 | TFKVKDKITCYGSSWISKATYHSCDGDTGYFILYAQNGNSYIHKGVPLSVWEKFKSADSFGSYYSKYIKGKYQ |
| A0A095D3R4 | 31-106 | AGRLSHMQVCRFDTSSIIDRAGYDDETRLLCLRFLDTGCYFYFEVPRSLFDALCAADSAGQFFNEHIKGRFRFERD |
| A0A7H5F4L8 | 5-77 | None |
| A0A1W9QAU0 | 17-93 | None |
| A0A426W2G7 | 95-172 | None |
| A0A644SWW8 | 7-73 | None |
| A0A1Z4RX77 | 136-203 | None |
| A0A1H8XP45 | 45-118 | None |
| A0A2Z2NZP3 | 11-114 | None |
| A0A6M0F778 | 88-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.