DPCstruct | MC18379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059NXZ4 | 5-64 | GCIKCGSTDAGKKDVAMTGAGLAKMLDVQNNKFTVVYCKNCGYSEFYNQNASKAGNIFDF |
| A0A1I6V577 | 1-62 | MSEKGCIKCGSKDAKMKDMAIPGTGFSMFPNEFIVVFCNNCGYSEFYNKKVSSGSNVLDYFF |
| D2V4W8 | 38-113 | None |
| A0A2E1WLM1 | 1-72 | None |
| V4IZH2 | 18-82 | None |
| W7YIB6 | 1-79 | None |
| A0A369BQF0 | 66-136 | None |
| A0A643JUC2 | 4-64 | None |
| J2ZT95 | 34-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.