DPCstruct | MC18377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 215 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5K3G5 | 4-199 | QDRARHELLLRLAPRLPDDVVWQARSWSASDQWPHAARLVVQVFLEWNQPLPPDAREVLLDGVDPATAERVEQLEDADELSVQLWDF… |
| D3CXG2 | 57-288 | VDAHDREMTEAWHWALLGLAGYLPDELVHQARTWLAAGQRLEVASAVAFALLSGQIDVGGGEIPLIREELAATASDPDLLRALDTVP… |
| A0A7W5VE84 | 8-240 | None |
| A0A543F8W2 | 3-210 | None |
| A0A292YLR2 | 12-233 | None |
| A0A0M8YKI1 | 2-209 | None |
| A0A511D0U4 | 12-231 | None |
| A0A7J9VBC6 | 1-227 | None |
| A0A263D5R2 | 5-225 | None |
| A0A6M0KH66 | 4-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.