DPCstruct | MC18376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.38 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0509- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7LY48 | 5-133 | YDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTYTGAKIIQNARLLVEKIGKPLELDTDGIWCALPGSFPENFTFKTRDPKKQF… |
| A0A813PQV4 | 107-214 | MSVFLSLIDDGFTSIAAWTVSYPFDVIKSRYHATRDHRYDIWCVLPAAFPENYELIIRDPSRPKFIISYPCSLLNLIIKDHYTNDQY… |
| A0A813UEE3 | 233-309 | None |
| A0A820SP40 | 191-293 | None |
| A0A820TFL3 | 2-102 | None |
| A0A1I8F8E6 | 23-123 | None |
| A0A158R252 | 11-132 | None |
| A0A2H2IZA8 | 5-131 | None |
| A0A0M0K3P2 | 568-694 | None |
| A0A452YAV9 | 5-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.