DPCstruct | MC18375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 3.65 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 57.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821GQP9 | 30-106 | MLTWTCIGSGRSGLYTHFFRHRDNCIHCASEMEDKPQEVEEKHRDIQKLQKLNNEQRPWSEWDRTYESCVQHTGHDI |
| A0A813PQ02 | 1-72 | MLSWTCIGSGKSGLYTNYYRHRDSCNYCAPELEEEKQQIMKEKKQQFRALNGKQPPWSEWGRSDESCVRPTG |
| A0A817RBK1 | 332-398 | None |
| A0A813YTP8 | 30-106 | None |
| A0A822E5G4 | 1-76 | None |
| A0A817E9M8 | 31-109 | None |
| A0A819WKB0 | 30-104 | None |
| A0A821GDU9 | 30-107 | None |
| A0A815ZA61 | 30-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.