DPCstruct | MC18370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 193 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8EZP0 | 108-285 | AWERCRATINSSSVKSLNLSLFAYRLSISGPDFSKIGYLLNTKRITARLDPTHPHAAEYVPEDDEIILKSLPSDQLDRSFIVHEAVH… |
| A0A1W9QU75 | 1-208 | MSALTDIVKVLRSPGCQNINFQYKNIKVSGSGFRKIASEILLGHIKIVSSFTVPSNAAKYNFIYNYLVTGIFPEKNLIVHECTHALN… |
| A0A6G6YMH5 | 1-192 | None |
| A0A4Q3R0X7 | 21-213 | None |
| A0A4V2NKI5 | 5-202 | None |
| A0A653ZI27 | 10-198 | None |
| A0A0D1EMB3 | 30-224 | None |
| A0A3A0DUX8 | 229-418 | None |
| A0A5D0V8K0 | 127-332 | None |
| A0A4Q0S4K8 | 99-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.