DPCstruct | MC1837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.50 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0010- PF20648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3RV55 | 1-54 | MVKVGDIIKIIEMLGEPLYTGKTGVVEHIDSLGQLHGSWGGLAVQPENDRFEVI |
| K8E644 | 120-186 | KETVFRLKEQYPPGTRVELIYMDDPYSKLKPGDQGTVSYVDDIGTVHIDWDCGSSLGVAYGVDMIRK |
| A0A229TED8 | 6-77 | None |
| A0A1H7QAF0 | 2-68 | None |
| A0A252F649 | 5-78 | None |
| R6R1P7 | 7-57 | None |
| A0A1M6XL84 | 2-61 | None |
| A0A7Z0QG45 | 8-70 | None |
| E7GC07 | 4-72 | None |
| A0A517T1X6 | 67-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.