DPCstruct | MC18369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A450YRI5 | 2-65 | KDKNTIIESLGLERHREGGYFSETYRSTQQVETDRPGGNRSLMTAIYYMLTDDNPILYFHVNLS |
| A0A1W9QQE2 | 1-66 | MNNTAKYWIDKLNLKKHPEGGYFREIYRSNEFINKKNLPDRYSSFRSFSTSIYFLLKSSEFSAFHS |
| A0A4D6M1X1 | 914-979 | None |
| A0A846DFH2 | 2-67 | None |
| A0A0K2RLK9 | 10-71 | None |
| A0A7Z7IQZ1 | 24-81 | None |
| A0A353R1U6 | 26-99 | None |
| A0A2K3PFH2 | 10-71 | None |
| A0A845EV34 | 1-68 | None |
| A0A662A7A2 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.