DPCstruct | MC18368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 206 ± 19 aa |
| Standard deviation of domain lengths | 19.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0QH22 | 1-175 | MVTAIDDYSAQPGPFAALDEEDADEEKKEEHGGGSSSGSKSAPLNFTQDPTPPSTPQTPPSKQRKHSVGSRKLQLRPDPYTPSDKDA… |
| A0A6A3GF31 | 1-175 | MGTAVDDYSAQPGPFAILDEDSPDEEKKEGDDSGSGSSSKDAPLDFTQDPTPPATPQTPPSKRSKASPTSSRKLQLRPDSYTPSTED… |
| G4ZJJ7 | 197-441 | None |
| A0A6A3R4T3 | 1-166 | None |
| H3H471 | 139-355 | None |
| A0A6G0QW04 | 36-238 | None |
| A0A6G0QQA1 | 1-213 | None |
| A0A6A3NNW4 | 105-318 | None |
| A0A6G0SDD9 | 89-301 | None |
| W2PC97 | 1-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.